SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046334|ref|YP_362509.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046334|ref|YP_362509.1|
Domain Number 1 Region: 82-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.87e-35
Family DsbA-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78046334|ref|YP_362509.1|
Sequence length 271
Comment thiol:disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MKTRFALTLMALLPILVACKAQDGSSDTAPAATTPAAETAPAPAAATPAADPAAPPAVGE
SATTPPPAAPSAAPRAPNGPEPVAGTDYLDIDAGQPYQQAAGKIEVAEVFGYVCPACNAF
QPLIGPWKAGLPSDVHFVYVPAMFGGTWDDYGRAFYAAETLGVQEKTHEALYKAIHVDQT
LKGERGKDSVQDIAAFYAKYGVDQKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSLII
NGKYLIKGQSFPDMLRIADHLIARERATLAK
Download sequence
Identical sequences Q3BXK4
316273.XCV0778 gi|78046334|ref|YP_362509.1| WP_011346385.1.100156 WP_011346385.1.13735 WP_011346385.1.199 WP_011346385.1.21317 WP_011346385.1.23534 WP_011346385.1.27112 WP_011346385.1.29361 WP_011346385.1.39371 WP_011346385.1.40690 WP_011346385.1.46449 WP_011346385.1.46677 WP_011346385.1.55770 WP_011346385.1.60785 WP_011346385.1.64411 WP_011346385.1.66420 WP_011346385.1.67180 WP_011346385.1.67877 WP_011346385.1.75734 WP_011346385.1.772 WP_011346385.1.81489 WP_011346385.1.8544 WP_011346385.1.89212 WP_011346385.1.89360 WP_011346385.1.99285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]