SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78046487|ref|YP_362662.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78046487|ref|YP_362662.1|
Domain Number 1 Region: 7-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.56e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 86-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000198
Family Glutathione S-transferase (GST), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78046487|ref|YP_362662.1|
Sequence length 213
Comment glutathione transferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MPLPRLVIGDKTLSSWSLRPWLLLRHFRVPFEEVALPLATPEFQARIAGYSPTRQVPVLW
DDALHVWDSLAICEYINERWLDGRGWPTDLAVRAQARAAAAEMHSGFAALRSQLPMNLAR
APGPAQWDAAAERDITRIQALWASLRAEHGHAGQFLCGQFGIVDAMYAPVALRFSSYGVP
LFEAAGDYVAALDALPALRDWRNGAQRERAERS
Download sequence
Identical sequences A0A0G8UC99 Q3BX51
gi|78046487|ref|YP_362662.1| WP_008572606.1.100156 WP_008572606.1.100312 WP_008572606.1.10442 WP_008572606.1.11230 WP_008572606.1.12827 WP_008572606.1.14159 WP_008572606.1.17112 WP_008572606.1.19776 WP_008572606.1.199 WP_008572606.1.20169 WP_008572606.1.21303 WP_008572606.1.21317 WP_008572606.1.2259 WP_008572606.1.23534 WP_008572606.1.24172 WP_008572606.1.25231 WP_008572606.1.3003 WP_008572606.1.30677 WP_008572606.1.3440 WP_008572606.1.37569 WP_008572606.1.37942 WP_008572606.1.39371 WP_008572606.1.40690 WP_008572606.1.43396 WP_008572606.1.43419 WP_008572606.1.44794 WP_008572606.1.46449 WP_008572606.1.46677 WP_008572606.1.47244 WP_008572606.1.47958 WP_008572606.1.49886 WP_008572606.1.50405 WP_008572606.1.5224 WP_008572606.1.54158 WP_008572606.1.54709 WP_008572606.1.55770 WP_008572606.1.56262 WP_008572606.1.57452 WP_008572606.1.59767 WP_008572606.1.60785 WP_008572606.1.61221 WP_008572606.1.64411 WP_008572606.1.656 WP_008572606.1.66420 WP_008572606.1.67180 WP_008572606.1.67877 WP_008572606.1.6838 WP_008572606.1.72305 WP_008572606.1.75734 WP_008572606.1.772 WP_008572606.1.78066 WP_008572606.1.79359 WP_008572606.1.79878 WP_008572606.1.80975 WP_008572606.1.81489 WP_008572606.1.85024 WP_008572606.1.85152 WP_008572606.1.8544 WP_008572606.1.86099 WP_008572606.1.89212 WP_008572606.1.89360 WP_008572606.1.94781 WP_008572606.1.94946 WP_008572606.1.96073 WP_008572606.1.9928 WP_008572606.1.99285 316273.XCV0931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]