SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047088|ref|YP_363263.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047088|ref|YP_363263.1|
Domain Number 1 Region: 83-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.78e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 7-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.52e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78047088|ref|YP_363263.1|
Sequence length 212
Comment glutathione transferase [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MSSVRPPLTVHGMSSSGNCYKVRLLLEQLGSRYHWVEVDSVAGQTRTPEYLAKNPNGKVP
MVERDDGRVLTESNAILFWLAEGTPYLPTDAWQRAQALSWMFFEQYSHEPYVAVARFISL
WTPRDAARRAELPQLRARGEQALAVMEQHLQQHTWFTGSDYGIADIALFAYTHCAEDGGF
DLERLPAIGAWIQRVQGLPRFVPMPAAASVAA
Download sequence
Identical sequences A0A0G9ETI6 G2LZ25 Q3BVF0
WP_011346936.1.2230 gi|346724375|ref|YP_004851044.1| 316273.XCV1532 gi|78047088|ref|YP_363263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]