SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047863|ref|YP_364038.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047863|ref|YP_364038.1|
Domain Number 1 Region: 106-263
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.18e-32
Family Glutathione peroxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78047863|ref|YP_364038.1|
Sequence length 278
Comment thiol disulfide interchange protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MISVGPFSVQVVAVFAAVLLAWAVARMVAKRLPDSPYKAAGGMLMDAVFLGFVAARLGYI
AQWWDEYAQSPMSMFFIGDQGFTWWIGVAATLVFIWWRTRSTRALRRPVLVGVTAGLLAW
FAAGGVLELLQRSAPPLPALALATLDEKPVVLNSYIGRPVVLNLWASWCPPCRREMPVFE
QAQAQYPEIAFVMVNQGESAQQARAFLEAQGLQLKDVLLDPASQTMQAVASRGLPTTLFF
NEHGRLVDTHLGELSMASLKNTVSRRFAQSQQIKTEKE
Download sequence
Identical sequences A1W5P8 Q3BT75
gi|121593753|ref|YP_985649.1| WP_011347504.1.100156 WP_011347504.1.10851 WP_011347504.1.1166 WP_011347504.1.15547 WP_011347504.1.22175 WP_011347504.1.22218 WP_011347504.1.25034 WP_011347504.1.32398 WP_011347504.1.36423 WP_011347504.1.39107 WP_011347504.1.39276 WP_011347504.1.46677 WP_011347504.1.46794 WP_011347504.1.48997 WP_011347504.1.50840 WP_011347504.1.51974 WP_011347504.1.55042 WP_011347504.1.57447 WP_011347504.1.5773 WP_011347504.1.59344 WP_011347504.1.59475 WP_011347504.1.63472 WP_011347504.1.68100 WP_011347504.1.71282 WP_011347504.1.75714 WP_011347504.1.75887 WP_011347504.1.77749 WP_011347504.1.78085 WP_011347504.1.78834 WP_011347504.1.79438 WP_011347504.1.83765 WP_011347504.1.85154 WP_011347504.1.85744 WP_011347504.1.86513 WP_011347504.1.87490 WP_011347504.1.88184 WP_011347504.1.88381 WP_011347504.1.88916 WP_011347504.1.89212 WP_011347504.1.89316 WP_011347504.1.90836 WP_011347504.1.90933 WP_011347504.1.91074 WP_011347504.1.92898 WP_011347504.1.92934 WP_011347504.1.98528 232721.Ajs_1356 316273.XCV2307 gi|78047863|ref|YP_364038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]