SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78047922|ref|YP_364097.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78047922|ref|YP_364097.1|
Domain Number 1 Region: 24-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.38e-29
Family DsbC/DsbG C-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78047922|ref|YP_364097.1|
Sequence length 261
Comment hypothetical protein XCV2366 [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MEPKRPSIPMQVQAFRRRNRRLRWPWVLAAALVALLLIWLVSRSPGDSSPQPPAPASIMQ
PSGPPWQMGNPEGRFTLTLYADLECPFCREYFPQLKHWVGNNTDVALQWHHQPLAAHEPA
ASAEARLAECAAEAGGHAAFWQAVEWVYAHTRSDGQGLPDGLRYPESTPAVEQCMASEHP
DATIRAQAAEATKSGVTATPSLRLLDRQTGQAILLQGPIEGDALLSAMDMLAADNPASDA
AAVVTTPTSEMPADVVGDMPR
Download sequence
Identical sequences A1W5T7 Q3BT16
gi|78047922|ref|YP_364097.1| 232721.Ajs_1397 316273.XCV2366 WP_011347553.1.100156 WP_011347553.1.10851 WP_011347553.1.1166 WP_011347553.1.15547 WP_011347553.1.22175 WP_011347553.1.22218 WP_011347553.1.25034 WP_011347553.1.32398 WP_011347553.1.36423 WP_011347553.1.39107 WP_011347553.1.39276 WP_011347553.1.46677 WP_011347553.1.46794 WP_011347553.1.48997 WP_011347553.1.50840 WP_011347553.1.51974 WP_011347553.1.55042 WP_011347553.1.57447 WP_011347553.1.5773 WP_011347553.1.59344 WP_011347553.1.59475 WP_011347553.1.63472 WP_011347553.1.68100 WP_011347553.1.71282 WP_011347553.1.75714 WP_011347553.1.75887 WP_011347553.1.77749 WP_011347553.1.78085 WP_011347553.1.78834 WP_011347553.1.79438 WP_011347553.1.83765 WP_011347553.1.85154 WP_011347553.1.85744 WP_011347553.1.86513 WP_011347553.1.87490 WP_011347553.1.88184 WP_011347553.1.88381 WP_011347553.1.88916 WP_011347553.1.89212 WP_011347553.1.89316 WP_011347553.1.90836 WP_011347553.1.90933 WP_011347553.1.91074 WP_011347553.1.92898 WP_011347553.1.92934 WP_011347553.1.98528 gi|121593792|ref|YP_985688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]