SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78048084|ref|YP_364259.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78048084|ref|YP_364259.1|
Domain Number 1 Region: 43-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.09e-29
Family Glutathione peroxidase-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78048084|ref|YP_364259.1|
Sequence length 200
Comment thiol:disulfide interchange protein (c-type cytochrome biogenesis protein CcmG) [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MVESRSPRLPTAVLVGAIVLLLALAALLVYAVVRSGQDDRDALPSALIGKPAPEFALPLL
HDPAIVVHARELRGAPYIINVWGSWCPACREEHPVLSRFALTKRVRVIGYNWKDERNDAL
RWLEQLGNPYLLVVADQDGRTAIDFGIAAAPETFLVDGRGVVRWKYSGMLTQSIIDTQLI
PALSKIERSPTAAPDLHAKQ
Download sequence
Identical sequences A0A0G9ACT0 A0A1S1XI18 G2LV71 Q3BSK4
gi|346725229|ref|YP_004851898.1| WP_008573806.1.100156 WP_008573806.1.100312 WP_008573806.1.10442 WP_008573806.1.11230 WP_008573806.1.12827 WP_008573806.1.13735 WP_008573806.1.14159 WP_008573806.1.16263 WP_008573806.1.17112 WP_008573806.1.19776 WP_008573806.1.199 WP_008573806.1.20169 WP_008573806.1.21303 WP_008573806.1.2230 WP_008573806.1.2259 WP_008573806.1.23534 WP_008573806.1.24172 WP_008573806.1.25231 WP_008573806.1.27112 WP_008573806.1.29361 WP_008573806.1.3003 WP_008573806.1.30677 WP_008573806.1.331 WP_008573806.1.3440 WP_008573806.1.37569 WP_008573806.1.37942 WP_008573806.1.39371 WP_008573806.1.40690 WP_008573806.1.43396 WP_008573806.1.43419 WP_008573806.1.44794 WP_008573806.1.46449 WP_008573806.1.46677 WP_008573806.1.47244 WP_008573806.1.47958 WP_008573806.1.48351 WP_008573806.1.49886 WP_008573806.1.50405 WP_008573806.1.5224 WP_008573806.1.54158 WP_008573806.1.54709 WP_008573806.1.55770 WP_008573806.1.57452 WP_008573806.1.59767 WP_008573806.1.60785 WP_008573806.1.61221 WP_008573806.1.64411 WP_008573806.1.656 WP_008573806.1.66420 WP_008573806.1.67180 WP_008573806.1.67877 WP_008573806.1.6838 WP_008573806.1.72305 WP_008573806.1.75734 WP_008573806.1.772 WP_008573806.1.77810 WP_008573806.1.78066 WP_008573806.1.79359 WP_008573806.1.80975 WP_008573806.1.81489 WP_008573806.1.85024 WP_008573806.1.85152 WP_008573806.1.8544 WP_008573806.1.86099 WP_008573806.1.89212 WP_008573806.1.89360 WP_008573806.1.94781 WP_008573806.1.94946 WP_008573806.1.96073 WP_008573806.1.9928 WP_008573806.1.99285 316273.XCV2528 gi|78048084|ref|YP_364259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]