SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78049835|ref|YP_366010.1| from Xanthomonas campestris pv. vesicatoria str. 85-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78049835|ref|YP_366010.1|
Domain Number 1 Region: 42-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.15e-20
Family Glutathione peroxidase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78049835|ref|YP_366010.1|
Sequence length 196
Comment hypothetical protein XCV4279 [Xanthomonas campestris pv. vesicatoria str. 85-10]
Sequence
MARRFPWLWMGLLVACALIAVLAWQNRQLRVQQHWLQTRISTPYDGMYVPRIEATDGDGR
RHLLGAPHGPAQVLFFFTTTCPYCQRSAPTVLRAARQLQANLPGRPQLLGVCHCDAAQAA
RYAHVHGFDFPVVTLTDRRALMLFRARNVPLLMAIDGEGRVRHSHLGVFDTTERVQDLVA
ALRRTDAPAAFATVKE
Download sequence
Identical sequences A0A0G8V6G8 A0A1S1XPK9 Q3BMK3
WP_011349043.1.100156 WP_011349043.1.100312 WP_011349043.1.10442 WP_011349043.1.11230 WP_011349043.1.12827 WP_011349043.1.13735 WP_011349043.1.14159 WP_011349043.1.16263 WP_011349043.1.17112 WP_011349043.1.19776 WP_011349043.1.199 WP_011349043.1.20169 WP_011349043.1.21303 WP_011349043.1.21317 WP_011349043.1.2259 WP_011349043.1.23534 WP_011349043.1.24172 WP_011349043.1.25231 WP_011349043.1.27112 WP_011349043.1.29361 WP_011349043.1.3003 WP_011349043.1.30677 WP_011349043.1.331 WP_011349043.1.3440 WP_011349043.1.37569 WP_011349043.1.37942 WP_011349043.1.39371 WP_011349043.1.40690 WP_011349043.1.43396 WP_011349043.1.43419 WP_011349043.1.44794 WP_011349043.1.46449 WP_011349043.1.46677 WP_011349043.1.47244 WP_011349043.1.47958 WP_011349043.1.49886 WP_011349043.1.50405 WP_011349043.1.51091 WP_011349043.1.5224 WP_011349043.1.54158 WP_011349043.1.54709 WP_011349043.1.55770 WP_011349043.1.56262 WP_011349043.1.57452 WP_011349043.1.59767 WP_011349043.1.60785 WP_011349043.1.61221 WP_011349043.1.64411 WP_011349043.1.656 WP_011349043.1.66420 WP_011349043.1.67180 WP_011349043.1.67877 WP_011349043.1.6838 WP_011349043.1.68402 WP_011349043.1.72305 WP_011349043.1.75734 WP_011349043.1.772 WP_011349043.1.78066 WP_011349043.1.79359 WP_011349043.1.79878 WP_011349043.1.80975 WP_011349043.1.81489 WP_011349043.1.85024 WP_011349043.1.85152 WP_011349043.1.8544 WP_011349043.1.86099 WP_011349043.1.89212 WP_011349043.1.89360 WP_011349043.1.94781 WP_011349043.1.94946 WP_011349043.1.96073 WP_011349043.1.9928 WP_011349043.1.99285 316273.XCV4279 gi|78049835|ref|YP_366010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]