SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:19552 from Saccharomyces bayanus MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:19552
Domain Number 1 Region: 34-310
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.06e-95
Family Inorganic pyrophosphatase 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:19552
Sequence length 310
Comment YMR267W, Contig c754 23959-24891 reverse complement
Sequence
MSLLRMNSLVGKNRSLERLKQTLNILSVRNQRQLSTTQQGSKYTLGFKKYLKLQNGEVGS
FFHDVPLDLNEREKTVNMIVEVPRWTTGKFEISKELKFNPIIQDTKNGKLRFVNNIFPYH
GYIHNYGAIPQTWEDPTIEHELGNGDLALRGDNDPLDCCEIGSDVLEIGSVRKVKVLGSL
ALIDDGELDWKIIVISVNDPLYHKLDNLENVEKHFPGILDATREWFRKYKVPMGKPLNKF
AFREHYMDSDGAIKIIKECHNSWRKLVSGSLQAKYDNLPSIERAGKGVTLQDSSKPPSEI
PPEVQKWYYV
Download sequence
Identical sequences ORFP:19552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]