SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:21519 from Saccharomyces bayanus MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:21519
Domain Number 1 Region: 3-283
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.63e-112
Family Inorganic pyrophosphatase 0.0000000000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:21519
Sequence length 287
Comment YBR011C, Contig c805 154-1017
Sequence
MTYSTRQIGAKNTLEYKVYIEKDGKPISAFHDIPLYADKENNVFNMVVEIPRWTNAKLEI
TKEETLNPIIQDTKKGKLRFVRNCFPHHGYIHNYGAFPQTWEDPNESHPETKAVGDNDPI
DVLEIGETIAYTGQVKQVKALGVMALLDEGETDWKVIAIDINDPLAPKLNDIEDVEKYFP
GLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALDIIKETHEAWKQLIAGKSSDNKG
IDLTNATLTDTPTYSASASSSIPPASPKEDAPIDKSVDKWFFISGSV
Download sequence
Identical sequences ORFP:21519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]