SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|566003304|ref|YP_008916144.1| from Complete genome sequence of Methanobacterium sp. Mb1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566003304|ref|YP_008916144.1|
Domain Number 1 Region: 251-361
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|566003304|ref|YP_008916144.1|
Domain Number - Region: 18-222
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0732
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|566003304|ref|YP_008916144.1|
Sequence length 368
Comment hypothetical protein MBMB1_1300 [Methanobacterium sp. MB1]
Sequence
MFLYVASKKFPKLPNTLFLVLGSIVLVTVANLSSLGVEVVGHIPPGLPSLIIPDPALLDV
NILVTLAATVFLISFIEGYLFASEYAAKNRYKIDKNQELLALGISNIAVGMFQGLPVAGS
LSRTAVNNESGAKSQLASIVSGLIIMLVLLFFTGIFTNLPHAILAAIILFIIKNLVDIPH
FKSIYHFSKIEFSIAIITMLFVLFFGALEAIVIGVILSVVGLINKMYNPHIAVLGKMPGK
DQFLDIKRRPEAKRIPEVLIVRVDGSQIFLNNEDIKNRIFELIENDYKDTKLLILDFEAT
SFIDHSGAEMIEELYCEFKLRGIKITAANIYGPLRDSIRKTELEEEIVEGTIPLTIEDCI
KLWENEKS
Download sequence
Identical sequences U6EE49
gi|566003304|ref|YP_008916144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]