SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|566003340|ref|YP_008916180.1| from Complete genome sequence of Methanobacterium sp. Mb1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|566003340|ref|YP_008916180.1|
Domain Number 1 Region: 59-195
Classification Level Classification E-value
Superfamily Sortase 8.24e-20
Family Sortase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|566003340|ref|YP_008916180.1|
Sequence length 198
Comment peptidase C60 sortase A and B [Methanobacterium sp. MB1]
Sequence
MSRNNVLAIIIILACSTLAGSIAMAGYVQMENVTRAQNSVKDYQERMSNPVNALDPTDLQ
QTSTHSKLIIPKLNVNARIRSDTVNAYNAVYHYPESVMPGKPGECGILGHRTTYSGLFAN
ISSLQPGDEAIIQDFIQRKEYVYEVTSNGKDIRWDYKTNPIRFSQEGEARLLIVTCYPPG
KKQAAWITHLKLVSTRDL
Download sequence
Identical sequences U6EEK0
gi|566003340|ref|YP_008916180.1| WP_023992468.1.96908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]