SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|SAKL0E09482g from Lachancea kluyveri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|SAKL0E09482g
Domain Number 1 Region: 193-505
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.03e-63
Family Mitochondrial carrier 0.00022
Further Details:      
 
Domain Number 2 Region: 4-157
Classification Level Classification E-value
Superfamily EF-hand 3.48e-24
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|SAKL0E09482g
Sequence length 513
Comment highly similar to gnl|GLV|KLLA0C11363g Kluyveromyces lactis KLLA0C11363g and similar to YNL083W uniprot|P48233 Saccharomyces cerevisiae YNL083W SAL1 Probable transporter member of the Ca2 -binding subfamily of the mitochondrial carrier family with two EF-hand motifs Pet9p and Sal1p have an overlapping function critical for viability polymorphic in different S. cerevisiae strains [Saccharomyces kluyveri] Complete CDS. SAKL0E09482g
Sequence
MSIPEESEEERSKRYESLFQTIDVNKTGKVDLQALTKAFEKSDHPLKNSPEAINHIFHSL
DCNKDSIIDFEDFKKYVTTAELQIKQGFQKIDADKDGKIRPAELSNYLGKLREHYNTATP
EDHPKESRSTKFIQWAFHKKDTYITYDQWRDFLLFMPRKEGSRLHTAYSYFYLFNEDVDL
SSEGDVTLINDFIRGFGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKV
LMKNPNADISKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQL
MAHLEGVHHTSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLIS
TARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTI
SNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQG
LFKGLVPNLAKVCPAVSISYLCYENFKRLMKLE
Download sequence
Identical sequences gnl|GLV|SAKL0E09482g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]