SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:10061 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:10061
Domain Number 1 Region: 96-415
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.74e-61
Family Cystathionine synthase-like 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:10061
Sequence length 420
Comment YHR112C, Contig c666 16177-17439 reverse complement
Sequence
MALCNTRYINVIYSSITSCNRYFLNVMDCIDVKADCVKRVSKMVDLSTSLIHGDDKDNRV
TDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLAHPNSTRLESIFSEILDGY
AVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRNYDIKQYPLEDIEKYASEG
DIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPPLQYVWNFGADIVLYSATK
YFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSEN
ATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYGPVFAITLQTKEQCKQLPL
KLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESANDLIKDLASALKELQDAA
Download sequence
Identical sequences ORFP:10061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]