SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:11976 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:11976
Domain Number 1 Region: 47-438
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.31e-94
Family AAT-like 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:11976
Sequence length 444
Comment YJL060W, Contig c342 8442-9776
Sequence
MKQRFIRQFANIMSTSKPKFVANKYFTSNTAKDVWSLTNEAAAQAANNSKNQGRELINLG
QGFFSYSPPQFAIKECQKALEIPLVNQYSPTRGRPSLINSLIKLYSPIYNKDLTTENVTV
TTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRNTR
GEEWTIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVY
EHLYFTDSFTRIATISPEIGQLTLTVGSAGKLFAATGWRIGWVVSLNADLLSYVSKAHTR
ICFSSPSPLQEACANSIDDGLKIGYFEKMRQEYITKFKIFTSIFDELGLPYTAPEGTYFV
LVNFSKVKIPKDYPYPEEIRDKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAAENLLR
FAVCKDDSYLEKAVERLRLLKDYL
Download sequence
Identical sequences ORFP:11976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]