SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:12348 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:12348
Domain Number 1 Region: 10-451
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.1e-63
Family Cystathionine synthase-like 0.0000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:12348
Sequence length 452
Comment YLR231C, Contig c1189 96-1454 reverse complement
Sequence
MEKALELDREYPESLKDEFNIPTFKSMGLSPDSKPVTYLCGNSLGLMPKSTRDSINAELD
AWSNCAVESHFKHPEEAKGKAPWVNIDLPILPLLAPMVGAQENEVAAMNSLTTNLNSLLV
TFYKPTEKRFKILFERGSFPSDYYAFYNQCRIHGISEPENVLIQIEPREGETYIRTQDIL
DTIEVNQDELALVCLPGVQYYTGQYFDIGRITSFAHQFPGILVGWDLAHAVGNVPLQLHD
WGVDFACWCSYKYLNAGPGGIGGLFVHSKHTTAGPTKEHLPRLAGWWGNDASKRFQMLEV
FEPISGALGFRQSNPSVVDTVALRSSLELFAKFNGIGEVRKRSLLLTNYMTELLKASKYY
KHPLKIEKLPYFFTILTPTGADDDHGAQLSLYFDSAGKEDIMPKVFQYLHDHGVIGDARR
PNVIRLAPAPLYNTFSDVYVAVNALNEAMDKL
Download sequence
Identical sequences ORFP:12348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]