SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:12675 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:12675
Domain Number 1 Region: 267-636
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.39e-43
Family Cystathionine synthase-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:12675
Sequence length 639
Comment YJR130C, Contig c741 47865-49784 reverse complement
Sequence
MISRAVGESIPPNTKHAVSVCLPTWEATVGYEEGESDIINSLTTGYPRFFVHKSIKKLCE
SLCGKYSMENETCLCFPSYRVANRCREFIKVKTGLSTKVRILQLCTPKPMNQEEKLWRRE
CKITVVFVDQEIFPVMKQYWQHSGEIVSSRMAEYILHELRVKDSSKEMKTIANGRKTVTE
DENRVNEEYVETRFGRSLNFLAADKAKYLIRKRIATKVVEKLDSESLSDLFSFEHYNENN
GPFSMGSGESLNNEPLTSDVPAETISSMGENSANSTFENMATEDLNFHVNPDTDVYLFPS
GMASIFTAHRLLLNLDANRLSRSSTRQDKLVGYGPPFKKTVMFGFPYTDTLSILRKFNHT
HFLGQGDSTSMDALKSILHAGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDE
TVGGFVNIDVLPYADIVCSSLTKIFSGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGYED
CLWCEDALCLERNSRDFVERTIKVNTNTNILLTKVLLPQVGKLFKKIYYPSLTSEETKRN
YDSVISTKDGGYGGLFSLTFFSIEEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQEL
DEIAQYGVEKNLVRVSVGLENSDVLCKVFQRAIEKALEE
Download sequence
Identical sequences ORFP:12675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]