SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:13264 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:13264
Domain Number 1 Region: 18-444
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.5e-89
Family AAT-like 0.000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:13264
Sequence length 451
Comment YKL106W, Contig c702 75964-77319
Sequence
MLRSKVSNWGLWRTYYTSSLSKVPRAPPDKVLGLSEHFKKAKNVNKIDLTVGIYKDGWGK
VTTFPSVARAQKLIESHFELNNNLSYLPITGSKEFQENVLNFLFKESCPQFGPFYLAHDR
ISFVQTLSGTGALAVAAKFLALFISRDIWIPDPSWANHKNIFQNNGFENIHRYSYYKDGQ
IDIDGWIKQLKTFAYNTQSENNKNPPCIILHACCHNPTGLDPTKEQWKEIIDTVYELNMV
PIVDMAYQGLESGNLLKDAYLLRLCLDVNRYPNWSNGIFLCQSFAKNMGLYGERVGSLSV
ITPATANDGNFNPLKQKNSLQQNIDSQLKKIVRGMYSSPPGYGSRVVNVVLSDIKLKQQW
FKDVDFMVQRLHYVRKEMFDRLGWPDLINFAQQHGMFYYTRFSPKQVEILRNDYFVYLTG
DGRLSLSGVNDSNIDYLCEALEAVSKMDQFA
Download sequence
Identical sequences ORFP:13264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]