SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:14204 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:14204
Domain Number 1 Region: 16-279
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.95e-39
Family Cystathionine synthase-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:14204
Sequence length 289
Comment Multiple, Contig c1370 70-939 reverse complement
Sequence
MTKFGKCKFFGFGDSRDITELQKFLGTSKQRILAVFVETPSNPLLNMPNLKDLRRLADQY
GFFIIIDDTIGGINVDILPYADIVCTSLTKLFNGASNVMGGSIVLNPKSSIYPYAREYFK
SADFEDLLWCEDAVVLERNSRDFENRTLHANANTEKLLNEVLIPEQGKLCKKVYYPTVTS
EETFRNYESVRNERGGYGCLFSVAFYNEGDAKAFYDSLKVFKGPSNGTNFTLACPYVHLA
HHSELEAVSKFGADPNIIRVSVGLEDTQWLLEVFSNALDVVRGRNFQHS
Download sequence
Identical sequences ORFP:14204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]