SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:15556 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:15556
Domain Number 1 Region: 16-421
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.95e-119
Family GABA-aminotransferase-like 0.00000000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:15556
Sequence length 424
Comment YLR438W, Contig c912 474-1748 reverse complement
Sequence
MSEATLSSKQTIEWENKYSAHNYHPLPVVFHKAKGAHVWDPEGKQYLDFLSAYSAVNQGH
CHPHIIKALTEQAQTLTLSSRAFHNDVYAQFAKFVTEFFGFETVLPMNTGAEAVETALKL
ARRWGYMKKNIPQDKAIILGAEGNFHGRTFGAISLSTDYEDSKLHFGPFVPNVASGHSVH
KIRYGHAEDFVPILESPEGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLII
DEIQTGIGRTGELLCYDHYKVDCKPDIVLLGKALSGGVLPVSCVLSSHDIMSCFTPGSHG
STFGGNPLASRVAIAALEVIRDEKLCQRAAQLGGSFIAQLKALQAKSNGVISEVRGMGLL
TAIVIDPSKANGKTAWDLCLLMKDHGLLAKPTHDHIIRLAPPLVISEEDLQTGVDTIAKC
IGML
Download sequence
Identical sequences ORFP:15556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]