SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:16094 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:16094
Domain Number 1 Region: 351-694
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.07e-37
Family Cystathionine synthase-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:16094
Sequence length 699
Comment YML082W, Contig c552 53161-55260
Sequence
MRCRLAKSGDENLMKKLPLTSECRTSRATQTPTGQAKFSPYSYSFREHYNMVSAQVATKL
GQPIPLDTQHAISVCFPTWESVISYVEKDSKVLGCLKSGYPRFWIHPSIQKLRDILTEKY
AKENETCFCFPSYRVAKRCREYIRMKCAHRNGKVRILQLATAKPINEEQKTWKRECKIAV
VFVDQAYENMLKQYWQYTGEIISSRLAEYVLHEFFVVEKKSSSAEEKEYIETRYGRNLNF
AFADRAKELIKKRIATKVIDKDEHDEEENYHFFAGNQDERDFQDTFLDSSLNEANHGEDH
GDGIGGELDNHSEPHDGLVSTIPPEPIEMSTIEEEQSLEEDAGRCALRVCPERDVFLFPS
GMASIFTAHRLLLQWDSLRLNRSRNGNDATSSPPNKKTVIFGFPYADTLHVLQEFNETYF
LGEGDSTSMKELTKILHSGEQILAVFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETV
GGIVNIDGLPFADIVCGSLTKTFSGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLL
WCEDAIYLERNSRDFIARTIRINYSTEYLLDKILKAHVGENGLFKKIYYPSLTSKETLIN
YDMVRCKKEGGYGGLFSLTFHDEDHAAAFYNNLQLNKGPSLGTNFTLAFPYTLMTYYHEL
AMAEKFGVERNLLRISVGLESQSTLGKIFQEAIDKTLKI
Download sequence
Identical sequences ORFP:16094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]