SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:17112 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:17112
Domain Number 1 Region: 70-511
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.87e-91
Family Glycine dehydrogenase subunits (GDC-P) 0.00000321
Further Details:      
 
Domain Number 2 Region: 541-959,1002-1024
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.9e-88
Family Glycine dehydrogenase subunits (GDC-P) 0.000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:17112
Sequence length 1034
Comment YMR189W, Contig c448 8506-11610
Sequence
MFRTRVATILNRATARSSANCVFSARARSFHSRSILLKAAVADISSLQYTRTYNPDLKNI
GRPLDTFARRHLGPSPKDVDKMLKTMAYSDLNAFIEELVPPNILKRRPLELEAPSKGFCE
QEMLQQLEEIANKNLYKVKNFIGKGYYGTILPPVIQRNLLESPEWYTSYTPYQPEISQGR
LEALLNFQTVVSDLTGLPVANASLLDEGTAAGEAMLLSFNLSRKKKFKYVIDKKLHQQTK
SVLYTRAKPFNIEIVEIDCSDIKSAIDVLKTPDISGCLVQYPATDGSILPPDAMKQFSEA
LHSHKSLLSVASDLMALTLLKPPAEYGADIVLGSSQRLGVPMGYGGPHAAFFAVIDKLNR
KIPGRIVGVSKDRLGNRALRLALQTREQHIKRDKATSNICTAQALLANVASSYCVYHGPK
GLQNISRRIFSLTSILANAIKDDSSPHQLVNQTWFDTLTIKLGNGISSQQLLDRALKEFN
INLFAVDGTSVSLSLDETTTKSDVENLLKVFDVENSTEFLSRDYSNCFPTEFQRTDEILK
NEVFHKHHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKLNSTVEMMPITWPQFSNIHP
FQPSSQVQGYKELISSLEKDLCSITGFDGISLQPNSGAQGEYTGLRVIRSYLESKGEDHR
NICLIPVSAHGTNPASAAMAGLKVVPVNCLEDGSLDLVDLKAKAEKHSEELAAVMITYPS
TYGLFEPGIQHAIDIVHSFGGQVYLDGANMNAQVGLTSPGDLGADVCHLNLHKTFSIPHG
GGGPAGAPICVKSHLIPHLPKHDVVDMITAVGSEKSIDSVSSAPYGNALVLPISYAYIKM
MGNEALPFSSVIAMLNSNYMMTRLRDHYKILFVNESSTLKHCAHEFIVDLREYKAKGVEA
IDVAKRLQDYGFHAPTLAFPVPGTLMVEPTESENLEELDRFCDAMISIKGEINAFISGQP
KGQILKNAPHSLEDFITSSDWDTRGYTREEAAYPLPFLRYNKFWPTVARLDDTYGDMNLI
CTCPSVEEVASETD
Download sequence
Identical sequences ORFP:17112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]