SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:18941 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:18941
Domain Number 1 Region: 17-473
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.96e-97
Family GABA-aminotransferase-like 0.00000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:18941
Sequence length 480
Comment YNR058W, Contig c985 7665-9107 reverse complement
Sequence
MSQEISYTPAVTELLDFDKKHIWHPYTSLKSPLNVYPVKSAHGCKLVLDTDSPVDVEVID
AMSSWWCVIHGYNNSELNEALTNQMLKFSHVLLGGFTHKGAVNLVQKLLKVIDEPTLQYC
FLADSGSVAVEVALKMALQANMSEEATKSRTKFLTIKNGYHGDTFGAMSVCDPENSMHYI
YKDRLSENIFAQAPSIIDGLPTSQNGFEDHWNEEEANDIKKQFELHSDEICAVILEPILQ
GAGGLRPYHPQFLIEVQKLCNQYDVLFIMDEIATGFGRTGEIFAFKHCQKYQDKLGISSA
KQVNVVPDIMCVGKGLTSGYMTMSAVVVNDKVASRISSPNSPTGGCFMHGPTFMGNALAC
SVAEKSMDILLRGEWRNQVSRIESQIYRELYKYIKTPENGLIGTIVKRVSVIGAVGIVEL
YQKTDPEWFQKKFISKGVHIRPFNCLCYIMPPYVITTEEMSQVNQVLIEVLHEWKAHISQ
Download sequence
Identical sequences ORFP:18941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]