SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:20423 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:20423
Domain Number 1 Region: 9-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.22e-94
Family GABA-aminotransferase-like 0.000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:20423
Sequence length 395
Comment YOR184W, Contig c932 184-1371 reverse complement
Sequence
MSLEREEPQHFGAGPAQMPTPVLQQAAKDLINFNDIGLGIGEISHRSKDATKVIEDSKKH
LIELLNIPDTHEVFYLQGGGTTGFSSLATNLAAAYVGKHGEIAQAGYLVTGSWSQKAYEE
AKRLHVPAEVIFNAKDYNNGKFGTIPDESLWEDKIKGKKFSYVYLCENETVHGVEWPSLP
KCLVEDPNIEIVADLSSDILSRKIDISQYGVIMAGAQKNIGLAGLTLYIVKKSILKNISG
APDETLHEIGVPITPIAFDYPTVVKNNSAYNTIPIFTLHVMDLVFQHILKKGGVEAQQAE
NEEKAKILYDALDSNPDFYTLPVDPKCRSKMNVVFTLKKDDLDDQFLKEAAARKLTGLKG
HRSVGGFRASIYNALSVQAVQNLVDFVKEFAEKNA
Download sequence
Identical sequences ORFP:20423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]