SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:2091 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:2091
Domain Number 1 Region: 99-466
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.71e-109
Family Cystathionine synthase-like 0.0000000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:2091
Sequence length 467
Comment , Contig c214 23178-24578
Sequence
MLKSTTARSITRLCQLYNVPAVAYRTSLTDKRFYSPPAAGVKLDDNFSLETHTDIQAAAK
AQASARASASGTTPDAVVASGSTAMSHAYQENTGFGTRPIYLDMQATTPTDPRVLDTMLK
FYTGLYGNPHSNTHSYGWETNTAVENARTHVARMINADPKEIIFTSGATESNNMVLKGVP
RFYKKTKKHIITTRTEHKCVLEAARAMMKEGFEVTFLNVNDQGLIDLKELENAIRPDTCL
VSVMAVNNEIGVIQPIKEIGALCKKNKIYFHTDAAQAYGKIHMDVNEMNIDLLSISSHKI
YGPKGIGAIYVRRRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGEAARLMKKEFDNDQ
DHIKRLSDKLVKGLLSAEHTTLNGSPDHRYPGCINVSFAYVEGESLLMALRDIALSSGSA
CTSASLEPSYVLHALGKDDALAHSSIRFGIGRFSTEEEVDYVVKAVS
Download sequence
Identical sequences ORFP:2091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]