SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:3714 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:3714
Domain Number 1 Region: 32-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.05e-67
Family AAT-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:3714
Sequence length 507
Comment YDR111C, Contig c1085 1655-3178
Sequence
MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK
PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG
RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSL
LSLLCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE
KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK
KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS
ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK
PQGAMYLFPRLVLPEKALRESERLEIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR
TTFLAPGTQWIQDWKHFHQDFFNKYRD
Download sequence
Identical sequences ORFP:3714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]