SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:372 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:372
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.26e-63
Family GABA-aminotransferase-like 0.000000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:372
Sequence length 215
Comment YNR058W, Contig c889 2181-2828 reverse complement
Sequence
MESIVQGAGGLRMYHPYFLKRVHELCNEFNILLILDEVAVGLGRTGKLFGFEHAGIVPDI
VCLGKTLTAGYLTLSATVTTRKIGDLISNGPEGCFMHGQTYMANPLACAVASENLSILME
GKWKSQVGKIETQLKKELLPLLEHHIVADVRILGAIGVVEVMKRVNVEDLQERFVKAGAW
IRPFNNIIYILPPYIITTEELSILTEAIKTVLDFI
Download sequence
Identical sequences ORFP:372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]