SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:375 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:375
Domain Number 1 Region: 7-181
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.16e-40
Family GABA-aminotransferase-like 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:375
Sequence length 193
Comment YNR058W, Contig c889 2908-3489 reverse complement
Sequence
MRDQLTQEDLEFDKKHIWHPYTSITTPLKVYPVTRAEGSYLYLDNGTKVVDGMASWWCVQ
QGYNNHRLNAAAITQINKMSHVMFGGITHKAGITFCKKLLTLLPDTLECALLADSGSISV
DIAMKMALRYHHSLGNTSKKKFLTIEKGYHGDAFGAVSVCDPVNSRHSTYNGFLAEKYSA
RLPKSVLIVPRKR
Download sequence
Identical sequences ORFP:375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]