SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:4931 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:4931
Domain Number 1 Region: 23-488
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.31e-175
Family GABA-aminotransferase-like 0.000000000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:4931
Sequence length 490
Comment YBR263W, Contig c697 25471-26943
Sequence
MLPRVSALAKCMATVHRRGLLTSGAQSLVSKPVSEGDPEMFDILQQERFRQKHSITLIPS
ENFTSKAVMDLLGSELQNKYSEGYPGERYYGGNEIIDKSESLCQARALELYGLDPAKWGV
NVQPLSGAPANLYVYSAIMNIGERLMGLDLPDGGHLSHGYQLKSGTPISFISKYFQSMPY
HVDHTTGLIDYDNLQVLAKAFRPKVIVAGTSAYSRLIDYAKFKEISQECGAYLMSDMAHI
SGLVAANVVPSPFEYSDIVTTTTHKSLRGPRGAMIFFRKGIKSVTKKGKEIPYELEKKIN
FSVFPGHQGGPHNHTIGAMAVALKQAMSPEFKEYQQKIVDNSKWFAQELTKRGYKLVSGG
TDNHLIVIDLSSTNVDGARVETILSALNIAANKNTIPGDKSALFPSGLRIGTPAMTTRGF
GREEFSQVAKYIDSAVKLAENLKALEPTTKLDARSRLNEFKKLCNESSEVASLSEEISNW
VGQYPVPGEV
Download sequence
Identical sequences ORFP:4931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]