SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:5560 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:5560
Domain Number 1 Region: 16-243
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.03e-77
Family AAT-like 0.00000924
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:5560
Sequence length 251
Comment Multiple, Contig c1358 28-783
Sequence
MTEFELPPEYTTAANDLRSDTFTTPTAEMVQAALEASIGDAVYGEDVDTVRLEQTVARMA
AKEAGLFCVSGTLSNQIAIRTHLTQPPYSILCDYRAHVYTHEAAGLAILSQAMVVPVVPS
NGDYLTLEDIKSHYVPDDGDIHGAPTRLISLENTLHGIVYPLEELVRIKAWCMENGLKLH
CDGARIWNAAAQSGVPLKQYGEIFDSISICLSKSMGAPIGSVLVGNLKFIKKATHFRKQQ
GRWYQTIWYDG
Download sequence
Identical sequences ORFP:5560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]