SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:5562 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:5562
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000392
Family AAT-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:5562
Sequence length 101
Comment Multiple, Contig c1358 773-1078
Sequence
MMARMALVNINNDWKSQLLYSHSLAHDLAQFCEEKGIPLESPADTNFVFINLKAARMDPD
VLVKKGLKYNVKLMGGKSFLPLPRSPKTLLEKVKLAHLRGL
Download sequence
Identical sequences ORFP:5562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]