SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:6264 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:6264
Domain Number 1 Region: 6-435
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.25e-54
Family AAT-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:6264
Sequence length 443
Comment YER152C, Contig c843 14271-15602
Sequence
MAYREINFFKGHPSSRLLPREAVIQATAAVLGPETREYDDDPYNRHPLTYGSDEGALWVR
EQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHNGYTRQAFIITP
TYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDSTTEIIQGPALT
KKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVYDILDYTTPSNELA
SPPLRMVHIDRSTAPLGQASFGNTISNATFSKLIAPGLRFGYHESINSNLARQLSKGGAN
VSGGTPSQLNSMIVGELLRSGAAQRCIAHLRSVYAERAAILTAALKKCMPLGTEITPVKG
GYFTWVTLPPAYNAVEISTVLANKFNVILANGSNFEVIGDEKNWGQSSFRLSISYLEADQ
IERGIELLGAVCKSYATTNNIIM
Download sequence
Identical sequences ORFP:6264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]