SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:7089 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:7089
Domain Number 1 Region: 8-55,91-492
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.99e-70
Family AAT-like 0.0000484
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:7089
Sequence length 500
Comment YGL202W, Contig c734 981-2483
Sequence
MTLPESKDFSYLFSDETNARKPSPLKTCIHLFHDPNIIFLGGGLPLKDYFPWDNLSVDSP
KPPFPYGIGAPIDEQNSIKYTVKKDYPDGNSNSHNDIPLSRALQYGHSGGQPELLDFLRE
HTKIIHDLKYKDWDVFATAGNTNAWESTLRLFCNRGDVILAEAHSFSSSLASAEAQGVIT
FPVPIDADGIIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQK
HDFLIVEDEPYYFLQMNPYIKDLKEREKAQNCPKQDHDEFLKSLANTFLSLDTEGRVIRM
DSFSKVLAPGTRLGWITGSSRILKHYLSLHEMTVQSPAGFTQVLVSSTLSRWGQKGYLDW
LLGLRHEYTLKRDCAIDALYKYLPQCDAFVINPPIAGMFFTVNIDASTHPEFSTKYNSDP
YQLEQSIYHKVVERGVLVVPGSWFKSEGETEPPQPAESKEVSNPNVIFFRGTYAAVSPEK
LTEGIKRLGDTLYEEFGIAK
Download sequence
Identical sequences ORFP:7089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]