SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:7163 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:7163
Domain Number 1 Region: 22-404
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.5e-72
Family Cystathionine synthase-like 0.000000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ORFP:7163
Sequence length 465
Comment YGL184C, Contig c735 32688-34085 reverse complement
Sequence
MAFKTLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLSNETAQDYDYSRSGNPTRSVLQN
QIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQRLLNFF
KQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFVKCISPE
TTVVVDNTMMSGLNCNPLQLDPGCDVVYESATKYLNGHHDLMGGVIISKTAEIAAKLYFV
VNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTETNKTTKTRF
VGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSM
PCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDLLAAMVDADIIEIRENGKYLF
NKLNNNLAVNTTTDELHKPLSVYEEFYNQDFIRKDSELNVMGSKL
Download sequence
Identical sequences ORFP:7163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]