SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:7318 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:7318
Domain Number 1 Region: 41-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.26e-82
Family Cystathionine synthase-like 0.000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:7318
Sequence length 401
Comment YFR055W, Contig c267 1509-2714 reverse complement
Sequence
MIDSTELSDFGISTQLSVIGRNPDEQCGFVNPALYKGSTIIHKTLEDLEQRKGRFFYGTA
GSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHILITDSVYFPTRMLCD
GLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQNIPALVSVAKKHGIK
TILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLGLVSANEECWPLLRSTYDAMA
MLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWFKKRDEVEKVLHPAFEDCPGHEYWV
RDYKGSSGLFSIVLKDGFTRSGLENMVDNMKVFELGYSWGGYDSLITPVNPPTQRKAAPW
SHNGFALRIQVGLEELEDLKRDLELGFERLTEEISMTPLQI
Download sequence
Identical sequences ORFP:7318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]