SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ORFP:8177 from Saccharomyces mikatae MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:8177
Domain Number 1 Region: 7-361
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.04e-88
Family Cystathionine synthase-like 0.0000000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ORFP:8177
Sequence length 385
Comment YFL030W, Contig c514 47681-48838
Sequence
MTNSVDTLLIPGPIILSGAVQKALDVPSLGHTSPEFVSIFQRVLKNTRTVFKSDAASKSQ
PFVLAGSGTLGWDVFASNFALSKAPNKKVLVVSTGTFSDRFADCLRSYGAEVDVVEPLKI
GEAVPLELIAEKLSQNNYGALTVTHVDTSTAVLSDVKAISQVIKQKSPETFFVVDGVCSV
GCEEFEFDEWGMDFALTASQKAVGAPAGLSIFVCSSRFMDYTLNDSVNGQVHGYFSSLRR
WTPIMQDYEAGRGAYFATPPVQLINSLDVALKEVLEEGLSKRWDSHREMSDWFKDSLVND
LKLTSVAKYPSNMSAHGLTAVYVADPPSVIAFLKSHGIVIAGGIHKVIGPKYIRIGHMGV
TACDKNLPYMKNCFNLIKLALQRKK
Download sequence
Identical sequences ORFP:8177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]