SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ORFP:20617 from Saccharomyces paradoxus MIT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ORFP:20617
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily TPR-like 4.75e-17
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 2 Region: 510-699
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000365
Family Cyclin A/CDK2-associated p19, Skp2 0.071
Further Details:      
 
Domain Number 3 Region: 204-276
Classification Level Classification E-value
Superfamily F-box domain 0.0000000314
Family F-box domain 0.0051
Further Details:      
 
Domain Number 4 Region: 301-378,468-594
Classification Level Classification E-value
Superfamily RNI-like 0.0000204
Family 28-residue LRR 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ORFP:20617
Sequence length 733
Comment YOR080W, Contig c478 15703-17904
Sequence
MSSPGDAGVAIDSTVLKAIELGTRLFKSGEYLQAKRIFTNALRVCDSYSQEQIVRIRNAY
QLDTARPDKKQLYHPRYLKILDNICACYEKLNDLKSCLSVSQRLLKLGPGNIKCYIRCTR
TLIKLKDWKGAYKTCSRGLQLCDNDSPHLRQQKQFIKDNMVQKQDDKRKYIDPLEETKAV
KRKKTSNVTQLRQPKKKIKDTSGKTDLVGNLPIEVLPIILQRFTSRELVMLSLVCNKWRD
KILYHLDCFQEFNLTAITFKNFVKFMDFLQQNFTRTYRKYNLSQLKITSRITSEELRIAQ
LLFSKMPKCINFERLILSMPTLTTAQFIKLMVRESAGFFLELLELSLMITYRPDKQHEWE
ILQNCPLLKKIELIFVNSLVSISNRNNSIGSDSSFNMMTGDANMQTSAEDQDEQGIIQEK
VIYNELEKITLICDKKKIKNFPLCRALSRGHFPLLQKLTVTGVTFPMNNQGIINFEWLLN
FPNLKELWIEDNDNCELSRFLQLLKRSNVWRNLKKLTFRENKLYPIIDLDEDLPAANNDE
MPSVLFYRENLQNLEMLDLMGTSMSGSALSRLCEQKYLDGEKLRSLNIGNCPNIQFPNNH
VHTARMVLDVNSVLKRLSKLEEINLSHLSSLNDSTMKSFIINVPFLENLKRLDISHNFEI
TGISIYEFLKKFQLDHDNDTGGQPLTYLNIDGCSQVSHITVNMIRAQNLVTRVDCVYERD
VWKQFGINSYSYS
Download sequence
Identical sequences ORFP:20617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]