SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15607160|ref|NP_214532.1| from Mycobacterium tuberculosis H37Rv

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15607160|ref|NP_214532.1|
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily PP2C-like 1.44e-64
Family PP2C-like 0.000000000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15607160|ref|NP_214532.1|
Sequence length 514
Comment Phosphoserine/threonine phosphatase PstP [Mycobacterium tuberculosis H37Rv]
Sequence
MARVTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEVASQLVIAALAHL
DDDEPGGDLLAKLDAAVRAGNSAIAAQVEMEPDLEGMGTTLTAILFAGNRLGLVHIGDSR
GYLLRDGELTQITKDDTFVQTLVDEGRITPEEAHSHPQRSLIMRALTGHEVEPTLTMREA
RAGDRYLLCSDGLSDPVSDETILEALQIPEVAESAHRLIELALRGGGPDNVTVVVADVVD
YDYGQTQPILAGAVSGDDDQLTLPNTAAGRASAISQRKEIVKRVPPQADTFSRPRWSGRR
LAFVVALVTVLMTAGLLIGRAIIRSNYYVADYAGSVSIMRGIQGSLLGMSLHQPYLMGCL
SPRNELSQISYGQSGGPLDCHLMKLEDLRPPERAQVRAGLPAGTLDDAIGQLRELAANSL
LPPCPAPRATSPPGRPAPPTTSETTEPNVTSSPASPSPTTSAPAPTGTTPAIPTSASPAA
PASPPTPWPVTSSPTMAALPPPPPQPGIDCRAAA
Download sequence
Identical sequences A0A2C5SPX1 A5TY88 P9WHW5
NP_214532.1.84033 WP_010886062.1.11596 WP_010886062.1.11960 WP_010886062.1.16108 WP_010886062.1.28202 WP_010886062.1.29698 WP_010886062.1.30888 WP_010886062.1.34255 WP_010886062.1.39239 WP_010886062.1.47207 WP_010886062.1.48419 WP_010886062.1.48648 WP_010886062.1.51266 WP_010886062.1.53230 WP_010886062.1.59961 WP_010886062.1.62021 WP_010886062.1.6295 WP_010886062.1.67346 WP_010886062.1.68433 WP_010886062.1.71329 WP_010886062.1.75665 WP_010886062.1.78322 WP_010886062.1.83470 WP_010886062.1.8426 WP_010886062.1.84488 WP_010886062.1.85823 WP_010886062.1.91207 WP_010886062.1.9139 WP_010886062.1.93245 WP_010886062.1.9368 Rv0018c gi|148659777|ref|YP_001281300.1| gi|15607160|ref|NP_214532.1| gi|15607160|ref|NP_214532.1| 419947.MRA_0020 83332.Rv0018c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]