SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|554085698|ref|YP_008691263.1| from Candidatus Phytoplasma solani tobfin_28409

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|554085698|ref|YP_008691263.1|
Domain Number 1 Region: 23-84
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0000942
Family Rabaptin-5 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|554085698|ref|YP_008691263.1|
Sequence length 127
Comment hypothetical protein S284_01680 [Candidatus Phytoplasma solani]
Sequence
MESQIKDKETKRQEQEKKENEANTKKKRLQVELKQLEEDLERKKAEKQNLEQNIIPDLER
QLGESCERHTNLTQFYQEAQERFVNSLTNPPQPFIINFGEVFNPQPPYSFTTFPPKSTSK
PEPEGSN
Download sequence
Identical sequences U6DYM6
gi|554085698|ref|YP_008691263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]