SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|CMER|CMK166C from Cyanidioschyzon merolae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|CMER|CMK166C
Domain Number 1 Region: 409-777
Classification Level Classification E-value
Superfamily SIS domain 3.25e-95
Family double-SIS domain 0.000000709
Further Details:      
 
Domain Number 2 Region: 2-212,337-377
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.66e-49
Family Class II glutamine amidotransferases 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|CMER|CMK166C
Sequence length 778
Comment glucosamine--fructose-6-phosphate aminotransferase
Sequence
MCGIFAYVVYGVERSRDDIAAVLVNGLRRLEYRGYDSAGIALDDIVNPSTGERKPLVIKG
PGSVGCLAEQVATALRSSPNFKVRQHVGLAHTRWATHGAPSVENSHPQASGPENEFLVVH
NGIITNYAALKQVLGKRGYQFVSETDTEVVAVLLKHLYLEMKAVCDTVSFPRLVMLMMHE
LEGAYALAIRSQFFPGELVACKRGSPLVLGIAYHDGEQVHLVQHSEPAKTDASRSPASTP
GAVESEGTTRAAMSAAETATANGRFESSAVAAARQRDGLEPASSGSVAKSTGGRCFRRRT
PRRHSIDFKVAQVNLDCELPHGFSFNTSTSAPDSGMGERAGGVELFFASDVSALVEHTRE
VVVLEDNDVVHASADGSVDIFSFLDAESQSLLTQTRALCTLDIELEQIERGRFEHFMLKE
IFEQPESIRGTMRGRVQPATGTVLLGGLRERLDDLVRSNRLIFVGCGTSYHAALACRQLV
EQLTELPVSVELSSDFLDRACPLFRSDVCVFVSQSGETADTLEALRYAKRRHALTVGVVN
VVGSAIARITDCGVHLNAGCEIGVASTKSYTSQIVAIIMIALLLSADRLSKQTRRREIID
GLAALPTAIERVLMLNDKLRMLAVGVLRDAVSILVCGRGYQYATCLEAALKIKEVSYIHT
EGIHAGELKHGPLALIDQEMPMIVFATRDNGYEAICNAVHQLLARGNPQRMIVVCSEGDG
HFFQGLGVGTTLEVPHTADCLQGVVNIVPMQLIAYHLAVARGLNVDQPRNLAKSVTVQ
Download sequence
Identical sequences M1VCZ0
CMK166CT XP_005536573.1.94140 gnl|CMER|CMK166C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]