SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|CMER|CMT497C from Cyanidioschyzon merolae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|CMER|CMT497C
Domain Number 1 Region: 9-557
Classification Level Classification E-value
Superfamily SIS domain 1.11e-171
Family Phosphoglucose isomerase, PGI 0.00000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|CMER|CMT497C
Sequence length 574
Comment glucose-6-phosphate isomerase
Sequence
MASSGVHMHQVWRKLKTHASDVISNLHLAQLLQDEQRCTAFRATLNDLVYDYARQRATPE
TLSLLIEFADASELGAKIDRMFQGEKINLTEDRAVLHVALRAPRDPTIWPASVRLPEQAV
SEVHDVLAQIERFSERIRKGREWVGATGKPLTDVVSIGIGGSYLGPEFVYEALRTDHKAA
EAARGRRLRFLANVDPTDVHRALDGLNPETTLVVVVSKTFTTAETMLNARTLKRWLMDAL
GESAVAKHMVAVSTNTEAVKAFGIDPQEGMFRFWDWVGGRFSVCSAVGLVPLSLQYGFGI
MREFLAGAHEIDWHFATERDWRKNIPVLMGLFGVWNASFLGYSTRALLPYAQALLRFAPH
IQQVDMESNGKGVDIHGEALIDPTATGVVDFGEPGTNGQHSFYQLMHQGRVIPADFVGFR
RSQTPIVLEGEPVSNHDELMSNFFAQPDALAIGKTREELVAEGVPEALLNHKIFPGNRPS
SSMLFDCLDARTVGRLLALYEHRAAVEGFLWNLNSFDQWGVELGKVLAKRIRNELARRRQ
AEGKPAAGQAATDHHWNASTRFLLDAYFTPSTGQ
Download sequence
Identical sequences M1VCX8
XP_005539460.1.94140 CMT497CT gnl|CMER|CMT497C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]