SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|CMER|CMV059C from Cyanidioschyzon merolae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|CMER|CMV059C
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.39e-16
Family 7-Fe ferredoxin 0.0000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|CMER|CMV059C
Sequence length 81
Comment [pt] photosystem I p700 chlorophyll A apoprotein A1
Sequence
MAHTVKIYDNCIGCTQCVRACPLDVLEMVPWDGCKAGQMASAPRTEDCVGCKRCETACPT
DFLSIRVYLGGETTRSMGLAY
Download sequence
Identical sequences A0A060A8I3 Q85G47
CMV059CT gnl|CMER|CMV059C 5zgb_C 5zgh_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]