SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|CMER|CMV062C from Cyanidioschyzon merolae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|CMER|CMV062C
Domain Number 1 Region: 261-582
Classification Level Classification E-value
Superfamily SIS domain 5.94e-65
Family double-SIS domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 2-217
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.58e-52
Family Class II glutamine amidotransferases 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|CMER|CMV062C
Sequence length 583
Comment [pt] glucosamine-fructose-6-phosphate aminotransferase
Sequence
MCGIVAYVGHQNCESILLSALSHLEYRGYDSAGMAFILKNQQLVRLRAKGNLFNLSDKLL
KFQMMSSSPIHAQIGIAHTRWATHGEANEMNAHPHVDNEGRIAVVQNGIVHNYLAIKSRL
SPKVKFESHTDTEVIAHLIAFYQNEKGLDITNAIRNTINDLEGDLALAILSVNAPNEIFV
YSRNTPLIIGKCSDGYWCASDLVALNACEKYMRLPNDTLAKISAAKISAEKLARETQITE
AKWEAEWEAKWHRMPVLNIQKQGYDSYMLKEVFEQPKIIANIARWDEAKVKGWKKGIKSV
QLIAAGSSWHAALIGQYVLEKKARLTTRVWVASEYVKANPPLSACSLTLAISQSGETADV
LNAVKWERKRRKEQNCLYQCPIIAITNRKESTLAQYVNEIWPMNVGVEMAVAATKSFVAT
LMMLYKLAGIKTEELLPLASEVEHVLRTESTRMREMAEQVIKFPLCIFMGRGLLWPIAME
ASLKLTEVANLASLAYAAGEMKHGYLALLSQETLVICLSCADHQVEEIEARGASVMRLDL
EGEQIHVAIKTLVCLQMLSYYAAKLKGLDVDRPRHLAKSVTVF
Download sequence
Identical sequences Q85G44
gnl|CMER|CMV062C CMV062CT

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]