SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|CMER|CML244C from Cyanidioschyzon merolae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|CMER|CML244C
Domain Number 1 Region: 192-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-18
Family UAS domain 0.016
Further Details:      
 
Domain Number 2 Region: 372-490
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-18
Family UBX domain 0.006
Further Details:      
 
Weak hits

Sequence:  gnl|CMER|CML244C
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily UBA-like 0.000221
Family TAP-C domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|CMER|CML244C
Sequence length 529
Comment hypothetical protein, conserved
Sequence
MAATEDSQNETLALFKNIAALDDNEVARAILSAHNWNIERAVDAFLTRGVEGALQPPNRT
GSLEFASTSDTSGTTPDASELSSAPVSGQLHASRLSESQPLTPALAETSTPERALQPALA
QATPSGVLGHLRRLLALPFQALRMVLAWCASLVTRIMGIDRYYRYAGRSRAVGAAAVAEL
EENLRTRYGMTIRYPTIYHGTFKEALEHSTQRCKLVLLYLHSEIHHATDRFVREILSDES
FIQFVNENFVFYAASVNRSPEAVELASYFTPAGYPYLAVVFASRRWPLGQLIDLRVLSDL
DRSMRGGRDAPITATDVLLWLQNVLLEYGDALRTAHTMRERRRSAQRLREEQDREFQEAL
AADQAAERARREFEQRAREEAAEQDQRRRERMAMLDRKRAALGPEPEPGEHVVTVLLRLP
DGKSTQRRFELSRSFRDLFDWAETSADIDFDRFELTTNFPKRAYSPASHSAMTLAEAGFK
QRVALLVTEIGWTRALPDASGKADVSDGNGNVEQKHLEQGNSSESKKQV
Download sequence
Identical sequences M1UT04
gnl|CMER|CML244C CML244CT XP_005536867.1.94140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]