SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|148594|GID1.0039283 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dicpu1|148594|GID1.0039283
Domain Number - Region: 419-541
Classification Level Classification E-value
Superfamily Cyclin-like 0.000125
Family Cyclin 0.044
Further Details:      
 
Domain Number - Region: 67-140
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0792
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|148594|GID1.0039283
Sequence length 567
Sequence
MNQDIQYIQNNNNWLVNSNSQLQTNSLEYNTNLQTQINLQQQQQQQQINWQQQQQQQQQV
LNSTQNCYNSYYSTSNNNNSFIRNQQHLNLNFTHNNNFILYDPNLTFQNSLPTMPNNNTT
YYIDNNNNLQLHETMNNNIYTHNSYPSVMEAHNKMEKQILSHQQQQQQLQQQLQTNHPQP
QQVQELYSNNKNYSNVDSKNKTTKDVTYTYEATGNGTSIYNNSVSNNIYNANQAMQMAQE
IPTGQRQLQYQQQQLQQHQIQNKHQIQTTVAQQKKLQPSNNENDNNKEPQQHVKKSQQVV
VQQNHHTSVTTSNSIQIIEKDLIDKTLEQQQIQLELKTTKEERDKIQLHIEQHKMNIENH
ERIYKKPYLITSKVNEPFPKILSLENWNFVGETTSRIYQTLNQRADFHKRSSSCRVLLVK
KIFTWLVSHDKDYIKSHRTVDLVVAISDIINMIISLIELHRAPPNSILYLIIYSSDRFVE
RTGINHHQIFNLLLTSAIVNLKFWNECLYIQNKTIADIFSFSVKDLNTMERRFLYGLDYN
LCVTEEELNLFVDKLEKITISQSNLVK
Download sequence
Identical sequences F0ZBI7
XP_003284768.1.95606 jgi|Dicpu1|148594|GID1.0039283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]