SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|157915|GID1.0048569 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|157915|GID1.0048569
Domain Number 1 Region: 387-448
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.0000000144
Family Type 2 phosphatidic acid phosphatase, PAP2 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Dicpu1|157915|GID1.0048569
Domain Number - Region: 224-268
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0329
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|157915|GID1.0048569
Sequence length 492
Sequence
MGVQQQVELQPQSTVKYFHLKEEDASDINDIDIIKESSAPPRLSLMGWFAPPQYTAFPLG
KIVSGSSKNPLSLSEDSISSLDDKSIGIHTQPILMESSDGEDGAGPKDFKIDIHPTSSMD
KDIDDLKYNKKSTNTFLYSNAVTNNNSIRYQYSPVYSDVTYTLLVGIVILFSIVYSLLVG
PIKIMFAFLISLTIFISYTCAALSTNNRTYLYSVTVLSIALGLTIPAFFAATGAVVIGTD
RNKILWDSRLYASDSFLMGWLWPNGQMAKFVEDSTIVGPSSFIGKLSTEVFQLSYISYYV
WGYLMEVYILWNLWRCHLSTDPQKQRMMPIWDQRLKMFICSWISTYFIVFSINLIFPAIS
PRVYLKNLYSEKLTGFGFAGFIREKIDNAATGSFGSFPSGHIATSFAVGLSSYKILPAYG
FVSTISAILIAIATMYLRYHYFVDFLAAIPVTMFCLLYGGYYSPSDFFSVFVKCFTYTKT
IIQKTFQKIKNF
Download sequence
Identical sequences F1A0C2
XP_003293122.1.95606 jgi|Dicpu1|157915|GID1.0048569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]