SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|38686|e_gw1.265.17.1 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|38686|e_gw1.265.17.1
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.02e-22
Family alpha-D-mannose-specific plant lectins 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|38686|e_gw1.265.17.1
Sequence length 201
Sequence
MLHPVNSIRQDHPLCSNGNNQIETKDRKFHLVMQPDGNLVIYSGPHYPANSLWASNTDGK
GHGPYRLIMQGDGNLCIYDSHSVCTWSSGTHGQGIKGNYSAKFRKGQLLVLDTAKQIMWT
SKPSNKSNLLLGSSACAPSPAFPHHQPVVPQPVIPQPAYPHHQQPGFPSGYPGSAYQPVS
PYSQPAYPQPGYPSFTATKKW
Download sequence
Identical sequences F0ZUZ9
jgi|Dicpu1|38686|e_gw1.265.17.1 XP_003291237.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]