SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|80916|fgeneshDP_pg.C_scaffold_209000014 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|80916|fgeneshDP_pg.C_scaffold_209000014
Domain Number 1 Region: 30-126
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000759
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Domain Number 2 Region: 310-402
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000942
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 
Domain Number 3 Region: 864-950
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000055
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Domain Number 4 Region: 1658-1755
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000563
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Domain Number 5 Region: 574-658
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000222
Family alpha-D-mannose-specific plant lectins 0.0059
Further Details:      
 
Domain Number 6 Region: 1953-2038
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000523
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Domain Number 7 Region: 1407-1487
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000017
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Dicpu1|80916|fgeneshDP_pg.C_scaffold_209000014
Domain Number - Region: 738-801
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00196
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Domain Number - Region: 1126-1212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0648
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 
Domain Number - Region: 2109-2160
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0811
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|80916|fgeneshDP_pg.C_scaffold_209000014
Sequence length 2335
Sequence
MGYVKKQSILFLLGNDAVFNKFQIPLTPGGYWAAGSTFEVGASLSVGSIQLVLKNTGLSL
LVDGETVWSPYSFLTPNENALFQFNQDGEFFLFPKSGSPPVWRSNTYSLGGSYINILPSG
SYGRQWSIIVQDIDGQMVWGRFGPIVSSDNVIPLIPGSYIDRLNTTINKNFLTNGRYYLS
MGLSQNTSEAVGFYHGNPIEVSKSSLWSISKDYQEDSYSLFFTEDSKVCVGIVGEESHKW
CTSHNVTANQRYIVVPLEGYENIPNDDGFWYWVVLSSDYNISSIVSSRPLPVFDTKSIPL
TFKGSIHSSNGYINVGDSYTVGNTILSMTQDGIQLSHKGQIVWNPFTFSNSDVNAYALFG
TDGNFCIKTRLEGWCTSSHNLGGLYLNILPEGSYGREWGIVIQNTQGLMVWGRFGPAINK
KGIMPLIPGNFIDRLDPANNVLSTFITNGKNYLYVNKENDALRYLHECSSVWSVNKKSSD
SYQLYFQNNSNLCVGEINGSSNSWCNDIINSDQRYVVVPLNNEEMPEENGFWRWVTLNDS
KSIVFNITNFIKPVNDLKSIPLTQNGYLQAYSKFGVGHSITVGSIKLQMTSTGLQLLHNN
VVVWNPNPTLAANETAFAEFGIDGNLCIRTEKGTCISSHGLGGKYLNVLPYGSYGYKWAL
IIQNSEGLMVWGRFGPVIDFNSIPLIPGGFIDRLDPTNNKLLVGGRTFITNGRDYLSVNQ
KTFEAMGIYSNSNPFNKIDGDSIPVWSVNRTNVNINYRLYFKDDSNLCLGDINGPPNTWC
NNILSKNQRYVVVVPQNTYLSNNNGFWGIFVMDGNKNITDILSNQREQVFNKNRIPLSIN
GFIETKQKITTGNIISVDGTLLSKTITVGSIRLQMTNTGLQLLYNNDIVWNPFPLSTLNE
TAFAEFGQDGNLCIRSKVDWCTASHSLSGKYLNILPDGSYGRKWGIVIQNSEGIMVWGRF
GPAISDLGKLPLIPGNYIDRYDSSKRFISEKGFITNGRDYLSMNSRELEALGFYFNYNPN
NFILTQDSVWSVNKSSNLNYLLYFNDINDKLCVGEKGKELINTIYCADYFPNQRYVVIPP
PLNEYNETFYRWVILNDNNQVVYSLANRIEPIFDQKRIPLTTNGYLKAGDVLKYNQKLVV
GKTTLNVRGDGFELSHSGVVVYNPLSVGSEDKNAYLAFGVDGNLCFIHNSKPIFCIYSQT
LNGQYLNILPEGSYGREWAIVIQNSAGSMVWGRFGPIISDTGIMPLIPGNFIDRLDPTNN
ILTNFITNGRDYLSMNSREIEAMGFYYKNNPNNFVTPTSSAWSVGRMDNQNYKLEFSSSA
KELCVTAINSDGEYIWCSPTLKENIRYLVVPLQNNQVPQDDLYWRWVLLSDDFTDVFSIS
QKPPLVFNQLSIPLTKNGNQGRGRFTYLSVGNTELLMTDGLRIRHEGQVVWSLTSNHETS
YAQLHVDGNLCITDINGVDLNCTFTQGLGGEYVNILPEGSYGRKWGVVIQNNEGKMVWGR
FGPVISQEGNMPLIPGSFIDRLDINNNKISQFITNGYDYLSMNSRESEAVGFYKNNSPKN
LVYKTNPSWSISRSETNQRLYFDYINNLCMAPVGKENDPNWCNDIKNRNQRYVIVPLPGS
NLLPNDDDFWGWITLFDDKGIAYIASNKRLPVNSLDSIPLSPNGNIETNQTLTVGYKVTI
ANMILQMTSSGLHLLLNNEVVWSITSPIANGTAFIEFGIDGNLCIRTKEDWCTGSHSLGG
KYLNVLPEGSYGRKWAIVIQNSAGKMVWGRFGPIINTDGIMPLIPGSYIDRLDTTNNILT
NFITNGRHYLSMNQKPTEAIGLYFDRNPFNKIDYEPSRVWGYVKENSSLNYQFYFKDDSN
LCVGSGRSLAPVWCNNKLVNGRYLVLPIDSFGYPIETVAIWLLLDSDKGVVDHRSNINLP
VYDKDSIPLTPNGHIVASNSNLLTVNYNIKVDDTVLSFTNRGFKLYYKNEEVWSPYNFSP
SSSLVAFLKTDGNLCVKLSANDQLSTWCTLSNGFGGQYLNILPGGSYGRKWGIVIQNTQG
LMVWGRFGPAISTIGIMPLIPGNYIDRMGLYTSLNSTKNFITNGRDYLMASHGDFAMGLY
IDTNPHLYPNNKTWYFSKPTPTSTYNVIIQSDTNVCINDINTNTNIWCNMEHGQSQRYIV
MPLPNDEQGGWVTLNDNMELVYSRVVFIHSSIYTDGKTQPYLLPAQGLKNSFTSLSYNPG
TLIFTNLLNNKQLKSYVSSQETLLKPNFNGYGYSIISKNYFSFFAEYADCGILNCLCKNT
YFSLRGTPETLDRGDATFIGFNSLVPELLLVTSSGESLSNTKFYNISHYYPKYYI
Download sequence
Identical sequences F0ZRX3
XP_003290172.1.95606 jgi|Dicpu1|80916|fgeneshDP_pg.C_scaffold_209000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]