SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|91862|estExt_fgeneshDP_kg.C_910007 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|91862|estExt_fgeneshDP_kg.C_910007
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily PH domain-like 3.24e-28
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00099
Further Details:      
 
Domain Number 2 Region: 334-365
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0000000353
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|91862|estExt_fgeneshDP_kg.C_910007
Sequence length 367
Sequence
MSETAIFNATGQVFTYNPQVRNWVPSSNVPATLQMYYNSSANTYRVIGRAGDDPNNFLIN
FAVKSDVVYSRASEVFHQFTDQRTHFGINFTSKPDADTFGGGFEKVLATLKGGAPPAMKP
AAPPQQPAPQRPASTTIAKPVAPAAPAAPSQPPAAPAPPAPPAPPKPPGPPPPPPAAGAP
KPASGAGRGALLGSIENFSKNGLKKTVTVDKSNPLIGNTPAAPAPSSGGSTPASGGSTPA
ASTPKVSSGGGGGDLMAEVMAKRAKMKAAAAQPKEESTPVRDTPAPAPTPSHSFNKPSTA
PSFNKPSKPAAPPQSTKPSLSPSSTASPPSTVASEDLQSLKEEILAEVRKELKAMKDEIL
EAIRNSH
Download sequence
Identical sequences F0ZIE1
jgi|Dicpu1|91862|estExt_fgeneshDP_kg.C_910007 XP_003287187.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]