SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|94197|estExt_fgeneshDP_pm.C_730005 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|94197|estExt_fgeneshDP_pm.C_730005
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.35e-89
Family Inorganic pyrophosphatase 0.000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|94197|estExt_fgeneshDP_pm.C_730005
Sequence length 259
Sequence
MSGVVSKQVGETGSAQYRVFFLKDGKPVSPFHDVPLWVNKSQSVVNMLVEIPRGTNAKLE
IATKEYMNPIKQDTKDGKLRFVHDKYPFNYGALPQTWENPSVLDARTNAKGDNDPLDACE
IGSAQAAIGEFKQVKVLGVFAMIDAGETDWKILCIDVNDPAASLINSEEDLEKVLPGKVN
EVYTFLRDYKIPDGKGPNQFAFDGKLQNREFAVSVIEETEHEWKSLVAGKTESPLSIENV
SLNNSKTVTADEANAKLGF
Download sequence
Identical sequences F0ZGK2
XP_003286544.1.95606 jgi|Dicpu1|94197|estExt_fgeneshDP_pm.C_730005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]