SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dicpu1|157708|GID1.0048362 from Dictyostelium purpureum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicpu1|157708|GID1.0048362
Domain Number 1 Region: 103-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000772
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 
Weak hits

Sequence:  jgi|Dicpu1|157708|GID1.0048362
Domain Number - Region: 245-303
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0342
Family alpha-D-mannose-specific plant lectins 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicpu1|157708|GID1.0048362
Sequence length 312
Sequence
MYLTYQNDSNFCVGSGRNLAPVWCNNKLVNGRYLIIPIDSFGYLIETVAIWLLLDSNKGI
VDRRSNINLPVHNKESIPLTPNGHIVASDSNLLTVNYNIKVDDTRIQITLKNEEVWSPYD
FSPSTSPVAVLKTDGNLCVKLSATAQFSTWCTLNNDFGGQYLNILPGGSYGRKLGIVIQN
SKGLMVWSRFGPAISTIGIMPLIPGNYIDRFGLYTSLNPTKNFITNGRDYLMANHGDFSM
GLYIDTNPHLYPNNKTWYFSKPTPTSTYSVIIQSDTNVCINDINTKTNIWCNMEHGQSQR
YIVMPLPNDQQG
Download sequence
Identical sequences F0ZZS8
jgi|Dicpu1|157708|GID1.0048362 XP_003292919.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]